wwwmikesoto1 wwwmikesoto1

08-10-2020
History

contestada

3. the process of charting a course for a shop or aircraft
(14 Points)
navigation
astrolabe
caraval
merchant

Respuesta :

08-10-2020

i believe it’s navigation.
i hope i helped!

Answer Link

Otras preguntas

For the peptide YALGIIQAQPDKSESELVSQIIEELIKKEK, predict the electrospray ionization mass spectrum. Assume that the molecular weight of the uncharged peptide is

After a client has had a permanent demand pacemaker implanted, which finding by the nurse would be of most concern? 1) Blood on the dressing 2) Pulse rate 40 be

Select all of the following that are true about plasmids.

Company-Wide Overhead Rate Calculation: a) How is the company-wide overhead rate computed using machine hours? b) What is the company-wide overhead rate based o

Which hormone is made by adipose cells and suppresses appetite when body fat stores are high? a) Glucagonb) Insulinc) Both insulin and glucagon function in this

Sentences in the middle of a paragraph develop the topic sentence by? A.Going into further detail B.Altering the controlling idea C.Consideing the nat of the

What does logotherapy stand for?

(A) H2O(B) NH3(C) BH3(D) CH4(E) SiH4Has a central atom with less than an octet of electrons?

A message is being sent in binary code. Consider a message of length 1, i. e. , we send one bit, 0 or 1. Let us assume: a) There can only be one possible messag

Sketch simple icons to represent the following operations to appear on a digital camera screen: 1. Turn image 90-degrees sideways. 2. Crop the image. 3. Auto-e